Skip to main content

Table 1 List of identified proteins related to calcification in calcifying vesicles from tadem spectrometry. Data were analyzed using a Biowors 3.2 (ThermoFinnigan) program.

From: Induction of calcification by serum depletion in cell culture: a model for focal calcification in aortas related to atherosclerosis

Proteins Peptide Sequence
Calpactin I Heavy chain SNAQRQDIAFAYQR (2, 4.50, 0.32)
LSLEGDHSTPPSAYGSVK (2, 4.00, 0.40)
RAEDGSVIDYELIDQDAR (2, 3.69, 0.29)
GVDEVTIVNILTNR (1, 2.83, 0.29)
Calreticulin or CRP55 FYALSAR (1, 2.00, 0.44)
FKPFSNKGQPLVVQFTVK (2, 3.75, 0.64)
EPVVYFKEQFLDGDGWTER.G (2, 10.2, 0.54)
Integrin beta 1 SKGTAEKLQPEDITQIQPQQLVLQLR (1, 2.02, 0.36)
GTAEKLQPEDITQIQPQQLVLQLR (2, 5.42, 0.54)
LQPEDITQIQPQQLVLQLR (2, 5.42, 0.54)
SGEPQTFTLK (2, 2.02, 0.36)
Fibrillin IKGTQC#EDINEC#EVFPGVC#K (2, 3.00, 0.36)
IKGTQC#EDIDEC#EVFPGVCKNGLCVNTR (3, 4.58, 0.35)
ATPase β subunit VALTGLTVAEYFRDEEGQDVLLFIDNIFR (3, 2.70, 0.27)
AIAELGIYPAVDPLDSTSR (2, 4.76, 0.12)
ATP synthase ITSTKEGSITSIQAIYVPADDLTDPAPATTFAHLDATTVLSR (3, 5.69, 0.17)
VLDSGAPIKIPVGPETLGR (2, 3.81, 0.65)
ILQDYKSLQDIIAILGMDELSEEDKLTVSR (3, 3.78, 0.55)
ILGADTSVDLEETGRVLSIGDGIAR (2, 3.26, 0.19)
TGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSK (2, 5.13, 0.47)
AIAELGIYPAVDPLDSTSR (1, 3.0, 0.46)
  1. The following set of criteria for high confidence were used: minimum cross-correlation score of (Xcorr) of 1.9, 2.5 and 3.5 for 1, 2 and 3 charges ions respectively, a delta correlation score (Δcorr) greater than 0.1, and a minimum of 2. These parameters are presented in the parentheses in sequence of charges, Xcorr, and Δcorr. Database used was obtained from the NCBI repository. C# indicates a carboxymethylcisteine.